PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 281aa    MW: 32461.1 Da    PI: 4.7532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00780genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+  ++ +G ++W++ ++  g+ R++k+c++rw +yl
       AA31G00780 16 RGPWSPEEDMKLISFINNFGHENWRSLPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding52.98.7e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++k++G++ W++Ia++++ gRt++++k+ w+++l
       AA31G00780  69 RGNFSAEEEDMIIKLHKEFGNK-WSKIASKLP-GRTDNEIKNVWHTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-24766IPR009057Homeodomain-like
PROSITE profilePS5129413.571163IPR017930Myb domain
SuperFamilySSF466895.62E-3014110IPR009057Homeodomain-like
SMARTSM007172.7E-121565IPR001005SANT/Myb domain
PfamPF002491.6E-141663IPR001005SANT/Myb domain
CDDcd001676.68E-81863No hitNo description
PROSITE profilePS5129425.95664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2767119IPR009057Homeodomain-like
SMARTSM007178.1E-1668116IPR001005SANT/Myb domain
PfamPF002492.6E-1569114IPR001005SANT/Myb domain
CDDcd001678.51E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS PEEDMKLISF INNFGHENWR SLPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFSAEEEDMI IKLHKEFGNK WSKIASKLPG RTDNEIKNVW HTHLKKRLNQ  120
KSSRTESMLS DDKVEEEEGS LKGKVSQELS TSMSSSGGSN VINLEEEIGL TFEYIEAYNN  180
NTEFTDIIQE VDKPELLEIP FDSDPEIWSF LDSSKSNSSV SRVEEESDED EVKKWFKHLE  240
TELGLEEDDN QQQQQQHKQE TGNVEEAEES SLLKTYELMI H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25161197109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002887770.11e-132hypothetical protein ARALYDRAFT_477086
RefseqXP_006302583.11e-131hypothetical protein CARUB_v10020691mg
TrEMBLD7KVY91e-131D7KVY9_ARALL; Putative uncharacterized protein
TrEMBLR0GID11e-131R0GID1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__2216__AT1G79180.11e-131(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.11e-112myb domain protein 58